| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
| Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
| Protein Dihydroorotate dehydrogenase [51397] (8 species) |
| Species Trypanosoma cruzi [TaxId:353153] [254868] (49 PDB entries) |
| Domain d3w7ma_: 3w7m A: [237499] automated match to d3w1aa_ complexed with fmn, gol, nco, w7m has additional subdomain(s) that are not in the common domain has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3w7m (more details), 2.4 Å
SCOPe Domain Sequences for d3w7ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w7ma_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Trypanosoma cruzi [TaxId: 353153]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie
Timeline for d3w7ma_: