Lineage for d4nsqc1 (4nsq C:493-652)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969076Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)
  8. 2969203Domain d4nsqc1: 4nsq C:493-652 [237339]
    Other proteins in same PDB: d4nsqa2, d4nsqb2, d4nsqc2, d4nsqd2
    automated match to d1ygha_
    complexed with coa

Details for d4nsqc1

PDB Entry: 4nsq (more details), 2.31 Å

PDB Description: Crystal structure of PCAF
PDB Compounds: (C:) Histone acetyltransferase KAT2B

SCOPe Domain Sequences for d4nsqc1:

Sequence, based on SEQRES records: (download)

>d4nsqc1 d.108.1.0 (C:493-652) automated matches {Human (Homo sapiens) [TaxId: 9606]}
viefhvvgnslnqkpnkkilmwlvglqnvfshqlprmpkeyitrlvfdpkhktlalikdg
rviggicfrmfpsqgfteivfcavtsneqvkgygthlmnhlkeyhikhdilnfltyadey
aigyfkkqgfskeikipktkyvgyikdyegatlmgcelnp

Sequence, based on observed residues (ATOM records): (download)

>d4nsqc1 d.108.1.0 (C:493-652) automated matches {Human (Homo sapiens) [TaxId: 9606]}
viefhvvgnspnkkilmwlvglqnvfshqlprmpkeyitrlvfdpkhktlalikdgrvig
gicfrmfpsqgfteivfcavtsneqvkgygthlmnhlkeyhikhdilnfltyadeyaigy
fkkqgfskeikipktkyvgyikdyegatlmgcelnp

SCOPe Domain Coordinates for d4nsqc1:

Click to download the PDB-style file with coordinates for d4nsqc1.
(The format of our PDB-style files is described here.)

Timeline for d4nsqc1: