Lineage for d4niqa_ (4niq A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1481355Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1481714Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 1481728Family a.7.14.0: automated matches [191520] (1 protein)
    not a true family
  6. 1481729Protein automated matches [190877] (3 species)
    not a true protein
  7. 1481732Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [237334] (1 PDB entry)
  8. 1481733Domain d4niqa_: 4niq A: [237335]
    automated match to d1yxra1

Details for d4niqa_

PDB Entry: 4niq (more details), 2.3 Å

PDB Description: crystal structure of vps4 mit-vfa1 mim2
PDB Compounds: (A:) vacuolar protein sorting-associated protein 4

SCOPe Domain Sequences for d4niqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4niqa_ a.7.14.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakf
teylnraeqlkkhleseeanaa

SCOPe Domain Coordinates for d4niqa_:

Click to download the PDB-style file with coordinates for d4niqa_.
(The format of our PDB-style files is described here.)

Timeline for d4niqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4niqb_