SCOPe 2.08: Domain d4niqa_: 4niq A:

Lineage for d4niqa_ (4niq A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.14: MIT domain [116846] (2 families)

5. Family a.7.14.0: automated matches [191520] (1 protein)
   not a true family

6. Protein automated matches [190877] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [237334] (1 PDB entry)

8. Domain d4niqa_: 4niq A: [237335]
   automated match to d1yxra1

Details for d4niqa_

PDB Entry: 4niq, 2.3 Å

PDB Description: crystal structure of vps4 mit-vfa1 mim2

PDB Compounds: (A:) vacuolar protein sorting-associated protein 4

SCOPe Domain Sequences for d4niqa_:

Sequence; same for both SEQRES and ATOM records:

>d4niqa_ a.7.14.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakf
teylnraeqlkkhleseeanaa

Timeline for d4niqa_:

• d4niqa_ first appeared in SCOPe 2.03
  
• d4niqa_ appears in SCOPe 2.07