Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (42 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [188612] (13 PDB entries) |
Domain d4mj8a_: 4mj8 A: [237311] automated match to d3eg7a_ complexed with eoh, spm |
PDB Entry: 4mj8 (more details), 2.04 Å
SCOPe Domain Sequences for d4mj8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mj8a_ d.108.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]} nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnr
Timeline for d4mj8a_: