SCOPe 2.08: Domain d4fp1b1: 4fp1 B:3-132

Lineage for d4fp1b1 (4fp1 B:3-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [228629] (7 PDB entries)

8. Domain d4fp1b1: 4fp1 B:3-132 [237250]
   Other proteins in same PDB: d4fp1a2, d4fp1b2
   automated match to d3uxkd1
   complexed with bfm, mg

Details for d4fp1b1

PDB Entry: 4fp1, 1.68 Å

PDB Description: p. putida mandelate racemase co-crystallized with 3,3,3-trifluoro-2- hydroxy-2-(trifluoromethyl) propionic acid

PDB Compounds: (B:) mandelate racemase

SCOPe Domain Sequences for d4fp1b1:

Sequence; same for both SEQRES and ATOM records:

>d4fp1b1 d.54.1.0 (B:3-132) automated matches {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

Timeline for d4fp1b1:

• d4fp1b1 first appeared in SCOPe 2.03
  
• d4fp1b1 appears in SCOPe 2.07