![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
![]() | Protein automated matches [226997] (13 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [228631] (7 PDB entries) |
![]() | Domain d4fp1b2: 4fp1 B:133-359 [237252] Other proteins in same PDB: d4fp1a1, d4fp1b1 automated match to d3uxkd2 complexed with bfm, mg |
PDB Entry: 4fp1 (more details), 1.68 Å
SCOPe Domain Sequences for d4fp1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fp1b2 c.1.11.2 (B:133-359) automated matches {Pseudomonas putida [TaxId: 303]} pvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsirqavgddfgi mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv
Timeline for d4fp1b2: