Lineage for d4fp1b2 (4fp1 B:133-359)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836928Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2837122Protein automated matches [226997] (13 species)
    not a true protein
  7. 2837200Species Pseudomonas putida [TaxId:303] [228631] (7 PDB entries)
  8. 2837209Domain d4fp1b2: 4fp1 B:133-359 [237252]
    Other proteins in same PDB: d4fp1a1, d4fp1b1
    automated match to d3uxkd2
    complexed with bfm, mg

Details for d4fp1b2

PDB Entry: 4fp1 (more details), 1.68 Å

PDB Description: p. putida mandelate racemase co-crystallized with 3,3,3-trifluoro-2- hydroxy-2-(trifluoromethyl) propionic acid
PDB Compounds: (B:) mandelate racemase

SCOPe Domain Sequences for d4fp1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fp1b2 c.1.11.2 (B:133-359) automated matches {Pseudomonas putida [TaxId: 303]}
pvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv

SCOPe Domain Coordinates for d4fp1b2:

Click to download the PDB-style file with coordinates for d4fp1b2.
(The format of our PDB-style files is described here.)

Timeline for d4fp1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fp1b1