| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (55 species) not a true protein |
| Species Pseudomonas putida [TaxId:303] [228629] (5 PDB entries) |
| Domain d4fp1b1: 4fp1 B:3-132 [237250] Other proteins in same PDB: d4fp1a2, d4fp1b2 automated match to d3uxkd1 complexed with bfm, mg |
PDB Entry: 4fp1 (more details), 1.68 Å
SCOPe Domain Sequences for d4fp1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fp1b1 d.54.1.0 (B:3-132) automated matches {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar
Timeline for d4fp1b1: