Lineage for d4fp1b1 (4fp1 B:3-132)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413212Species Pseudomonas putida [TaxId:303] [228629] (5 PDB entries)
  8. 1413214Domain d4fp1b1: 4fp1 B:3-132 [237250]
    Other proteins in same PDB: d4fp1a2, d4fp1b2
    automated match to d3uxkd1
    complexed with bfm, mg

Details for d4fp1b1

PDB Entry: 4fp1 (more details), 1.68 Å

PDB Description: p. putida mandelate racemase co-crystallized with 3,3,3-trifluoro-2- hydroxy-2-(trifluoromethyl) propionic acid
PDB Compounds: (B:) mandelate racemase

SCOPe Domain Sequences for d4fp1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fp1b1 d.54.1.0 (B:3-132) automated matches {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

SCOPe Domain Coordinates for d4fp1b1:

Click to download the PDB-style file with coordinates for d4fp1b1.
(The format of our PDB-style files is described here.)

Timeline for d4fp1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fp1b2