SCOPe 2.07: Domain d4naza1: 4naz A:2-139

Lineage for d4naza1 (4naz A:2-139)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [237200] (5 PDB entries)

8. Domain d4naza1: 4naz A:2-139 [237201]
   Other proteins in same PDB: d4naza2
   automated match to d4jh2a_
   complexed with gol, so4, zn

Details for d4naza1

PDB Entry: 4naz, 1.15 Å

PDB Description: Crystal Structure of FosB from Staphylococcus aureus with Zn and Sulfate at 1.15 Angstrom Resolution

PDB Compounds: (A:) Metallothiol transferase FosB

SCOPe Domain Sequences for d4naza1:

Sequence, based on SEQRES records:

>d4naza1 d.32.1.0 (A:2-139) automated matches {Staphylococcus aureus [TaxId: 158879]}
lksinhicfsvrnlndsihfyrdillgkllltgkktayfelaglwialneekdiprneih
fsythiaftiddsefkywhqrlkdnnvnilegrvrdirdrqsiyftdpdghklelhtgtl
enrlnyykeakphmtfyk

Sequence, based on observed residues (ATOM records):

>d4naza1 d.32.1.0 (A:2-139) automated matches {Staphylococcus aureus [TaxId: 158879]}
lksinhicfsvrnlndsihfyrdillgkllltgkktayfelaglwialneekdiprneih
fsythiaftiddsefkywhqrlkdnnvnilqsiyftdpdghklelhtgtlenrlnyykea
kphmtfyk

Timeline for d4naza1:

• d4naza1 first appeared in SCOPe 2.03, called d4naza_
  
• d4naza1 appears in SCOPe 2.06
  
• d4naza1 appears in the current release, SCOPe 2.08