Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Staphylococcus aureus [TaxId:158879] [237200] (5 PDB entries) |
Domain d4naza1: 4naz A:2-139 [237201] Other proteins in same PDB: d4naza2 automated match to d4jh2a_ complexed with gol, so4, zn |
PDB Entry: 4naz (more details), 1.15 Å
SCOPe Domain Sequences for d4naza1:
Sequence, based on SEQRES records: (download)
>d4naza1 d.32.1.0 (A:2-139) automated matches {Staphylococcus aureus [TaxId: 158879]} lksinhicfsvrnlndsihfyrdillgkllltgkktayfelaglwialneekdiprneih fsythiaftiddsefkywhqrlkdnnvnilegrvrdirdrqsiyftdpdghklelhtgtl enrlnyykeakphmtfyk
>d4naza1 d.32.1.0 (A:2-139) automated matches {Staphylococcus aureus [TaxId: 158879]} lksinhicfsvrnlndsihfyrdillgkllltgkktayfelaglwialneekdiprneih fsythiaftiddsefkywhqrlkdnnvnilqsiyftdpdghklelhtgtlenrlnyykea kphmtfyk
Timeline for d4naza1: