Lineage for d4naza1 (4naz A:2-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2943052Species Staphylococcus aureus [TaxId:158879] [237200] (5 PDB entries)
  8. 2943053Domain d4naza1: 4naz A:2-139 [237201]
    Other proteins in same PDB: d4naza2
    automated match to d4jh2a_
    complexed with gol, so4, zn

Details for d4naza1

PDB Entry: 4naz (more details), 1.15 Å

PDB Description: Crystal Structure of FosB from Staphylococcus aureus with Zn and Sulfate at 1.15 Angstrom Resolution
PDB Compounds: (A:) Metallothiol transferase FosB

SCOPe Domain Sequences for d4naza1:

Sequence, based on SEQRES records: (download)

>d4naza1 d.32.1.0 (A:2-139) automated matches {Staphylococcus aureus [TaxId: 158879]}
lksinhicfsvrnlndsihfyrdillgkllltgkktayfelaglwialneekdiprneih
fsythiaftiddsefkywhqrlkdnnvnilegrvrdirdrqsiyftdpdghklelhtgtl
enrlnyykeakphmtfyk

Sequence, based on observed residues (ATOM records): (download)

>d4naza1 d.32.1.0 (A:2-139) automated matches {Staphylococcus aureus [TaxId: 158879]}
lksinhicfsvrnlndsihfyrdillgkllltgkktayfelaglwialneekdiprneih
fsythiaftiddsefkywhqrlkdnnvnilqsiyftdpdghklelhtgtlenrlnyykea
kphmtfyk

SCOPe Domain Coordinates for d4naza1:

Click to download the PDB-style file with coordinates for d4naza1.
(The format of our PDB-style files is described here.)

Timeline for d4naza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4naza2