SCOPe 2.08: Domain d4jdbb_: 4jdb B:

Lineage for d4jdbb_ (4jdb B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein Dihydroorotate dehydrogenase [51397] (8 species)

7. Species Trypanosoma cruzi [TaxId:353153] [254868] (49 PDB entries)

8. Domain d4jdbb_: 4jdb B: [237163]
   automated match to d3w1aa_
   complexed with fmn, gol, jdb, nco
   has additional subdomain(s) that are not in the common domain
   has additional insertions and/or extensions that are not grouped together

Details for d4jdbb_

PDB Entry: 4jdb, 1.82 Å

PDB Description: structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-005

PDB Compounds: (B:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d4jdbb_:

Sequence; same for both SEQRES and ATOM records:

>d4jdbb_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Trypanosoma cruzi [TaxId: 353153]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

Timeline for d4jdbb_:

• d4jdbb_ first appeared in SCOPe 2.03
  
• d4jdbb_ appears in SCOPe 2.07