Lineage for d3zlhb1 (3zlh B:0-139)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649704Species Streptococcus pyogenes [TaxId:286636] [236665] (3 PDB entries)
  8. 1649714Domain d3zlhb1: 3zlh B:0-139 [236677]
    Other proteins in same PDB: d3zlha2, d3zlhb2, d3zlhc2, d3zlhd2
    automated match to d1p43a2

Details for d3zlhb1

PDB Entry: 3zlh (more details), 2.9 Å

PDB Description: structure of group a streptococcal enolase
PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d3zlhb1:

Sequence, based on SEQRES records: (download)

>d3zlhb1 d.54.1.0 (B:0-139) automated matches {Streptococcus pyogenes [TaxId: 286636]}
hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksry
lglgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiava
raaadylevplytylggfnt

Sequence, based on observed residues (ATOM records): (download)

>d3zlhb1 d.54.1.0 (B:0-139) automated matches {Streptococcus pyogenes [TaxId: 286636]}
hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgastheavelrdgdksrylg
lgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavara
aadylevplytylggfnt

SCOPe Domain Coordinates for d3zlhb1:

Click to download the PDB-style file with coordinates for d3zlhb1.
(The format of our PDB-style files is described here.)

Timeline for d3zlhb1: