Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (67 species) not a true protein |
Species Streptococcus pyogenes [TaxId:286636] [236665] (3 PDB entries) |
Domain d3zlhc1: 3zlh C:0-139 [239949] Other proteins in same PDB: d3zlha2, d3zlhb2, d3zlhc2, d3zlhd2 automated match to d3zlhb1 |
PDB Entry: 3zlh (more details), 2.9 Å
SCOPe Domain Sequences for d3zlhc1:
Sequence, based on SEQRES records: (download)
>d3zlhc1 d.54.1.0 (C:0-139) automated matches {Streptococcus pyogenes [TaxId: 286636]} hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksry lglgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiava raaadylevplytylggfnt
>d3zlhc1 d.54.1.0 (C:0-139) automated matches {Streptococcus pyogenes [TaxId: 286636]} hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgavelrdgdksrylglgtqk avdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavaraaadyl evplytylggfnt
Timeline for d3zlhc1: