![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (42 species) not a true protein |
![]() | Species Plasmodium vivax [TaxId:5855] [234134] (12 PDB entries) |
![]() | Domain d2ynec1: 2yne C:27-210 [236664] automated match to d1iica1 complexed with cl, dms, mg, nhw, so4, yne |
PDB Entry: 2yne (more details), 1.72 Å
SCOPe Domain Sequences for d2ynec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ynec1 d.108.1.0 (C:27-210) automated matches {Plasmodium vivax [TaxId: 5855]} dykfwytqpvpkindefnesvnepfisdnkvedvrkdeyklppgyswyvcdvkdekdrse iytlltdnyvedddnifrfnysaefllwaltspnylktwhigvkydasnkligfisaipt dicihkrtikmaevnflcvhktlrskrlapvlikeitrrinleniwqaiytagvylpkpv sdar
Timeline for d2ynec1: