| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) ![]() |
| Family c.18.1.0: automated matches [193165] (1 protein) not a true family |
| Protein automated matches [193166] (6 species) not a true protein |
| Species Staphylococcus aureus [TaxId:282458] [236655] (2 PDB entries) |
| Domain d3wdfa_: 3wdf A: [236656] automated match to d1flza_ |
PDB Entry: 3wdf (more details), 1.48 Å
SCOPe Domain Sequences for d3wdfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wdfa_ c.18.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
mewsqifhdittkhdfkamhdflekeystaivypdreniyqafdltpfenikvvilgqdp
yhgpnqahglafsvqpnakfppslrnmykeladdigcvrqtphlqdwaregvlllntvlt
vrqgeanshrdigwetftdeiikavsdykehvvfilwgkpaqqkiklidtskhciiksvh
psplsayrgffgskpyskantylesvgkspinwces
Timeline for d3wdfa_: