Lineage for d3wdfb_ (3wdf B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855020Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2855021Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2855129Family c.18.1.0: automated matches [193165] (1 protein)
    not a true family
  6. 2855130Protein automated matches [193166] (6 species)
    not a true protein
  7. 2855164Species Staphylococcus aureus [TaxId:282458] [236655] (2 PDB entries)
  8. 2855166Domain d3wdfb_: 3wdf B: [239911]
    automated match to d3wdfa_

Details for d3wdfb_

PDB Entry: 3wdf (more details), 1.48 Å

PDB Description: Staphylococcus aureus UDG
PDB Compounds: (B:) uracil-DNA glycosylase

SCOPe Domain Sequences for d3wdfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wdfb_ c.18.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 282458]}
mewsqifhdittkhdfkamhdflekeystaivypdreniyqafdltpfenikvvilgqdp
yhgpnqahglafsvqpnakfppslrnmykeladdigcvrqtphlqdwaregvlllntvlt
vrqgeanshrdigwetftdeiikavsdykehvvfilwgkpaqqkiklidtskhciiksvh
psplsayrgffgskpyskantylesvgkspinwces

SCOPe Domain Coordinates for d3wdfb_:

Click to download the PDB-style file with coordinates for d3wdfb_.
(The format of our PDB-style files is described here.)

Timeline for d3wdfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3wdfa_