Lineage for d4m1ra_ (4m1r A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339836Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1340396Protein automated matches [190057] (15 species)
    not a true protein
  7. 1340445Species Soil metagenome [TaxId:410658] [236610] (1 PDB entry)
  8. 1340446Domain d4m1ra_: 4m1r A: [236612]
    automated match to d1egza_
    complexed with trs

Details for d4m1ra_

PDB Entry: 4m1r (more details), 1.8 Å

PDB Description: Structure of a novel cellulase 5 from a sugarcane soil metagenomic library
PDB Compounds: (A:) Cellulase 5

SCOPe Domain Sequences for d4m1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1ra_ c.1.8.3 (A:) automated matches {Soil metagenome [TaxId: 410658]}
mvapittsgnkvlfggqqgsiagnsffwsntgwggekyynaqtvawlksdwksslvraam
gvdesggyitdsynktrvttvvdaaiannmyviidwhshhaeqyqsqaiaffkematkyg
nnnnviyeiyneplqvswssvikpyataviaeirkidpdnlivvgtptwsqdvdvaandp
itgyaniaytlhfyagthgqslrnkastalskgiplfvtewgsvnadgggsvataetnsw
vsfmktnnisnanwalndkaegasalvsgasanggwtssqltasgtlaksiisgwp

SCOPe Domain Coordinates for d4m1ra_:

Click to download the PDB-style file with coordinates for d4m1ra_.
(The format of our PDB-style files is described here.)

Timeline for d4m1ra_: