SCOPe 2.06: Domain d4cgec_: 4cge C:

Lineage for d4cgec_ (4cge C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.0: automated matches [191411] (1 protein)
   not a true family

6. Protein automated matches [190563] (13 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [236519] (2 PDB entries)

8. Domain d4cgec_: 4cge C: [236524]
   automated match to d1xsfa1

Details for d4cgec_

PDB Entry: 4cge, 2.76 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis Resuscitation promoting factor E

PDB Compounds: (C:) resuscitation-promoting factor rpfe

SCOPe Domain Sequences for d4cgec_:

Sequence; same for both SEQRES and ATOM records:

>d4cgec_ d.2.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vnwdaiaqcesggnwsintgngyygglrftagtwranggsgsaanasreeqirvaenvlr
sqgirawpvcgr

Timeline for d4cgec_:

• d4cgec_ first appeared in SCOPe 2.03
  
• d4cgec_ appears in SCOPe 2.05
  
• d4cgec_ appears in SCOPe 2.07
  
• d4cgec_ appears in the current release, SCOPe 2.08