Lineage for d4cgec_ (4cge C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926515Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2926516Protein automated matches [190563] (18 species)
    not a true protein
  7. 2926551Species Mycobacterium tuberculosis [TaxId:1773] [236519] (2 PDB entries)
  8. 2926562Domain d4cgec_: 4cge C: [236524]
    automated match to d1xsfa1

Details for d4cgec_

PDB Entry: 4cge (more details), 2.76 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis Resuscitation promoting factor E
PDB Compounds: (C:) resuscitation-promoting factor rpfe

SCOPe Domain Sequences for d4cgec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cgec_ d.2.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vnwdaiaqcesggnwsintgngyygglrftagtwranggsgsaanasreeqirvaenvlr
sqgirawpvcgr

SCOPe Domain Coordinates for d4cgec_:

Click to download the PDB-style file with coordinates for d4cgec_.
(The format of our PDB-style files is described here.)

Timeline for d4cgec_: