![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
![]() | Protein automated matches [190563] (18 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [236519] (2 PDB entries) |
![]() | Domain d4cgec_: 4cge C: [236524] automated match to d1xsfa1 |
PDB Entry: 4cge (more details), 2.76 Å
SCOPe Domain Sequences for d4cgec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cgec_ d.2.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} vnwdaiaqcesggnwsintgngyygglrftagtwranggsgsaanasreeqirvaenvlr sqgirawpvcgr
Timeline for d4cgec_: