Lineage for d1gpl_1 (1gpl 337-449)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163751Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
  4. 163752Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families) (S)
  5. 163771Family b.12.1.2: Colipase-binding domain [49730] (1 protein)
  6. 163772Protein Pancreatic lipase, C-terminal domain [49731] (6 species)
  7. 163775Species Guinea pig (Cavia porcellus) [TaxId:10141] [49735] (1 PDB entry)
  8. 163776Domain d1gpl_1: 1gpl 337-449 [23645]
    Other proteins in same PDB: d1gpl_2

Details for d1gpl_1

PDB Entry: 1gpl (more details), 2.1 Å

PDB Description: rp2 lipase

SCOP Domain Sequences for d1gpl_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpl_1 b.12.1.2 (337-449) Pancreatic lipase, C-terminal domain {Guinea pig (Cavia porcellus)}
rwrykvsvtlsgkkvtghilvslfgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlq
mvkfiwynnvinptlprvgaskiivetnvgkqfnfcspetvreevlltltpc

SCOP Domain Coordinates for d1gpl_1:

Click to download the PDB-style file with coordinates for d1gpl_1.
(The format of our PDB-style files is described here.)

Timeline for d1gpl_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gpl_2