Class b: All beta proteins [48724] (178 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
Protein automated matches [190439] (22 species) not a true protein |
Species Brucella melitensis [TaxId:224914] [236401] (1 PDB entry) |
Domain d4iraa_: 4ira A: [236402] automated match to d3cb0a_ complexed with fad, so4 |
PDB Entry: 4ira (more details), 2.2 Å
SCOPe Domain Sequences for d4iraa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iraa_ b.45.1.0 (A:) automated matches {Brucella melitensis [TaxId: 224914]} stveskayrdamshyagavqivttagaagrrgltltaacsvsdnpptiliclqkiheenr ifiengvfaintlagphqqladafsgrigltqderfelaaweilatgapvlkgalaafdc rvvsvqdhsthhvlfgevvglsshaeeealiylnrryhklel
Timeline for d4iraa_: