SCOPe 2.06: Domain d4iraa_: 4ira A:

Lineage for d4iraa_ (4ira A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (20 species)
   not a true protein

7. Species Brucella melitensis [TaxId:224914] [236401] (1 PDB entry)

8. Domain d4iraa_: 4ira A: [236402]
   automated match to d3cb0a_
   complexed with fad, so4

Details for d4iraa_

PDB Entry: 4ira, 2.2 Å

PDB Description: CobR in complex with FAD

PDB Compounds: (A:) 4-hydroxyphenylacetate 3-monooxygenase

SCOPe Domain Sequences for d4iraa_:

Sequence; same for both SEQRES and ATOM records:

>d4iraa_ b.45.1.0 (A:) automated matches {Brucella melitensis [TaxId: 224914]}
stveskayrdamshyagavqivttagaagrrgltltaacsvsdnpptiliclqkiheenr
ifiengvfaintlagphqqladafsgrigltqderfelaaweilatgapvlkgalaafdc
rvvsvqdhsthhvlfgevvglsshaeeealiylnrryhklel

Timeline for d4iraa_:

• d4iraa_ first appeared in SCOPe 2.03
  
• d4iraa_ appears in SCOPe 2.05
  
• d4iraa_ appears in SCOPe 2.07
  
• d4iraa_ appears in the current release, SCOPe 2.08