Lineage for d4hrcj_ (4hrc J:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2597201Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2597210Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2598309Domain d4hrcj_: 4hrc J: [236384]
    Other proteins in same PDB: d4hrca_, d4hrco_
    automated match to d1rypk_
    complexed with ov2

Details for d4hrcj_

PDB Entry: 4hrc (more details), 2.8 Å

PDB Description: Crystal structure of yeast 20S proteasome in complex with epoxyketone carmaphycin analogue 3
PDB Compounds: (J:) Proteasome component C11

SCOPe Domain Sequences for d4hrcj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hrcj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddfqaq

SCOPe Domain Coordinates for d4hrcj_:

Click to download the PDB-style file with coordinates for d4hrcj_.
(The format of our PDB-style files is described here.)

Timeline for d4hrcj_: