SCOPe 2.01: Domain d1loxa2: 1lox A:2-112

Lineage for d1loxa2 (1lox A:2-112)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families)

5. Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)

6. Protein 15-Lipoxygenase [49728] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49729] (2 PDB entries)

8. Domain d1loxa2: 1lox A:2-112 [23638]
   Other proteins in same PDB: d1loxa1
   complexed with fe2, rs7

Details for d1loxa2

PDB Entry: 1lox, 2.4 Å

PDB Description: rabbit reticulocyte 15-lipoxygenase

PDB Compounds: (A:) 15-lipoxygenase

SCOPe Domain Sequences for d1loxa2:

Sequence; same for both SEQRES and ATOM records:

>d1loxa2 b.12.1.1 (A:2-112) 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvg

Timeline for d1loxa2:

• d1loxa2 first appeared (with stable ids) in SCOP 1.55, called d1lox_2
  
• d1loxa2 appears in SCOP 1.75
  
• d1loxa2 appears in SCOPe 2.02
  
• d1loxa2 appears in the current release, SCOPe 2.08