Lineage for d1lox_2 (1lox 2-112)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11920Fold b.12: Lipase/lipooxygenase domain [49722] (1 superfamily)
  4. 11921Superfamily b.12.1: Lipase/lipooxygenase domain [49723] (3 families) (S)
  5. 11922Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 11923Protein 15-Lipoxygenase [49728] (1 species)
  7. 11924Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49729] (1 PDB entry)
  8. 11925Domain d1lox_2: 1lox 2-112 [23638]
    Other proteins in same PDB: d1lox_1

Details for d1lox_2

PDB Entry: 1lox (more details), 2.4 Å

PDB Description: rabbit reticulocyte 15-lipoxygenase

SCOP Domain Sequences for d1lox_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lox_2 b.12.1.1 (2-112) 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus)}
gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvg

SCOP Domain Coordinates for d1lox_2:

Click to download the PDB-style file with coordinates for d1lox_2.
(The format of our PDB-style files is described here.)

Timeline for d1lox_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lox_1