Lineage for d1lox_2 (1lox 2-112)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.12: Lipase/lipooxygenase domain [49722] (1 superfamily) Superfamily b.12.1: Lipase/lipooxygenase domain [49723] (3 families) 
Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins) 
Protein 15-Lipoxygenase [49728] (1 species) Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49729] (1 PDB entry) 
Domain d1lox_2: 1lox 2-112 [23638]
Other proteins in same PDB: d1lox_1
Details for d1lox_2
PDB Entry: 1lox (more details), 2.4 Å
PDB Description: rabbit reticulocyte 15-lipoxygenase
SCOP Domain Sequences for d1lox_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lox_2 b.12.1.1 (2-112) 15-Lipoxygenase {Rabbit (Oryctolagus cuniculus)}
gvyrvcvstgasiyagsknkvelwlvgqhgevelgsclrptrnkeeefkvnvskylgsll
fvrlrkkhflkedawfcnwisvqalgaaedkywfpcyrwvvgdgvqslpvg
SCOP Domain Coordinates for d1lox_2:
Click to download the PDB-style file with coordinates for d1lox_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lox_2:
- d1lox_2 appears in SCOP 1.57
- d1lox_2 appears in the current release, SCOPe 2.08, called d1loxa2
View in 3D
