Lineage for d4lndb_ (4lnd B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224399Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2224400Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2224401Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2224457Protein automated matches [190454] (2 species)
    not a true protein
  7. 2224458Species Human (Homo sapiens) [TaxId:9606] [187368] (6 PDB entries)
  8. 2224463Domain d4lndb_: 4lnd B: [235891]
    automated match to d4lnda_
    complexed with mg

Details for d4lndb_

PDB Entry: 4lnd (more details), 1.92 Å

PDB Description: Crystal structure of human apurinic/apyrimidinic endonuclease 1 with essential Mg2+ cofactor
PDB Compounds: (B:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d4lndb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lndb_ d.151.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
yfllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d4lndb_:

Click to download the PDB-style file with coordinates for d4lndb_.
(The format of our PDB-style files is described here.)

Timeline for d4lndb_: