![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
![]() | Superfamily d.151.1: DNase I-like [56219] (4 families) ![]() |
![]() | Family d.151.1.1: DNase I-like [56220] (7 proteins) |
![]() | Protein automated matches [190454] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187368] (5 PDB entries) |
![]() | Domain d4lndb_: 4lnd B: [235891] automated match to d4lnda_ complexed with mg |
PDB Entry: 4lnd (more details), 1.92 Å
SCOPe Domain Sequences for d4lndb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lndb_ d.151.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld yfllshsllpalcdskirskalgsdhcpitlylal
Timeline for d4lndb_: