Lineage for d4c21b1 (4c21 B:1-353)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517702Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily)
    consists of two domains of similar topology, 3 layers (a/b/a) each
    Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345
    Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134
  4. 2517703Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) (S)
  5. 2517741Family c.85.1.0: automated matches [227251] (1 protein)
    not a true family
  6. 2517742Protein automated matches [227031] (3 species)
    not a true protein
  7. 2517772Species Streptococcus pneumoniae [TaxId:170187] [229523] (3 PDB entries)
  8. 2517776Domain d4c21b1: 4c21 B:1-353 [235857]
    Other proteins in same PDB: d4c21a2, d4c21b2, d4c21b3
    automated match to d4c21a1
    complexed with edo, foc, mn

Details for d4c21b1

PDB Entry: 4c21 (more details), 2.55 Å

PDB Description: L-Fucose Isomerase In Complex With Fucitol
PDB Compounds: (B:) l-fucose isomerase

SCOPe Domain Sequences for d4c21b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c21b1 c.85.1.0 (B:1-353) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
miqhprigirptidgrrqgvreslevqtmnmaksvadlisstlkypdgepvecvispsti
grvpeaaashelfkksnvcatitvtpcwcygsetmdmspdiphaiwgfngterpgavyla
avlashaqkgipafgiygrdvqeasdtdipedvkekllryaraalatglmrdtaylsmgs
vsmgiggsivnpdffqeylgmrnesvdmteftrrmdrgiydpeeferalkwvkenvkegf
dhnredlvlsreekdrqwefvikmfmigrdlmvgnprlaelgfeeeavghhalvagfqgq
rqwtdhfpngdfmetflntqfdwngirkpfvfatendslngvsmlfnylltnt

SCOPe Domain Coordinates for d4c21b1:

Click to download the PDB-style file with coordinates for d4c21b1.
(The format of our PDB-style files is described here.)

Timeline for d4c21b1: