Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily) consists of two domains of similar topology, 3 layers (a/b/a) each Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345 Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) |
Family c.85.1.0: automated matches [227251] (1 protein) not a true family |
Protein automated matches [227031] (2 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:170187] [229523] (3 PDB entries) |
Domain d4c21b1: 4c21 B:-16-353 [235857] Other proteins in same PDB: d4c21b2 automated match to d4c21a1 complexed with edo, foc, mn |
PDB Entry: 4c21 (more details), 2.55 Å
SCOPe Domain Sequences for d4c21b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c21b1 c.85.1.0 (B:-16-353) automated matches {Streptococcus pneumoniae [TaxId: 170187]} hhhhhssglvprgahmamiqhprigirptidgrrqgvreslevqtmnmaksvadlisstl kypdgepvecvispstigrvpeaaashelfkksnvcatitvtpcwcygsetmdmspdiph aiwgfngterpgavylaavlashaqkgipafgiygrdvqeasdtdipedvkekllryara alatglmrdtaylsmgsvsmgiggsivnpdffqeylgmrnesvdmteftrrmdrgiydpe eferalkwvkenvkegfdhnredlvlsreekdrqwefvikmfmigrdlmvgnprlaelgf eeeavghhalvagfqgqrqwtdhfpngdfmetflntqfdwngirkpfvfatendslngvs mlfnylltnt
Timeline for d4c21b1: