Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Bradyrhizobium sp. [TaxId:288000] [227810] (2 PDB entries) |
Domain d4nhzb1: 4nhz B:-9-103 [235775] Other proteins in same PDB: d4nhza2, d4nhzb2, d4nhzc2, d4nhzd2, d4nhze2, d4nhzf2, d4nhzg2, d4nhzh2, d4nhzi2, d4nhzj2, d4nhzk2, d4nhzl2, d4nhzm2, d4nhzn2, d4nhzo2, d4nhzp2 automated match to d4mf7a1 complexed with gsh |
PDB Entry: 4nhz (more details), 1.9 Å
SCOPe Domain Sequences for d4nhzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nhzb1 c.47.1.0 (B:-9-103) automated matches {Bradyrhizobium sp. [TaxId: 288000]} lgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephai dfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqylaektgq
Timeline for d4nhzb1:
View in 3D Domains from other chains: (mouse over for more information) d4nhza1, d4nhza2, d4nhzc1, d4nhzc2, d4nhzd1, d4nhzd2, d4nhze1, d4nhze2, d4nhzf1, d4nhzf2, d4nhzg1, d4nhzg2, d4nhzh1, d4nhzh2, d4nhzi1, d4nhzi2, d4nhzj1, d4nhzj2, d4nhzk1, d4nhzk2, d4nhzl1, d4nhzl2, d4nhzm1, d4nhzm2, d4nhzn1, d4nhzn2, d4nhzo1, d4nhzo2, d4nhzp1, d4nhzp2 |