Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (51 species) not a true protein |
Species Bradyrhizobium sp. [TaxId:288000] [227813] (2 PDB entries) |
Domain d4nhzb2: 4nhz B:104-234 [235776] Other proteins in same PDB: d4nhza1, d4nhzb1, d4nhzc1, d4nhzd1, d4nhze1, d4nhzf1, d4nhzg1, d4nhzh1, d4nhzi1, d4nhzj1, d4nhzk1, d4nhzl1, d4nhzm1, d4nhzn1, d4nhzo1, d4nhzp1 automated match to d4mf7a2 complexed with gsh |
PDB Entry: 4nhz (more details), 1.9 Å
SCOPe Domain Sequences for d4nhzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nhzb2 a.45.1.0 (B:104-234) automated matches {Bradyrhizobium sp. [TaxId: 288000]} flpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaeskrllgv learldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerglarpa vqrgleipkrp
Timeline for d4nhzb2:
View in 3D Domains from other chains: (mouse over for more information) d4nhza1, d4nhza2, d4nhzc1, d4nhzc2, d4nhzd1, d4nhzd2, d4nhze1, d4nhze2, d4nhzf1, d4nhzf2, d4nhzg1, d4nhzg2, d4nhzh1, d4nhzh2, d4nhzi1, d4nhzi2, d4nhzj1, d4nhzj2, d4nhzk1, d4nhzk2, d4nhzl1, d4nhzl2, d4nhzm1, d4nhzm2, d4nhzn1, d4nhzn2, d4nhzo1, d4nhzo2, d4nhzp1, d4nhzp2 |