SCOPe 2.05: Structural Classification of Proteins

PDB entry 4nhz

View 4nhz on RCSB PDB site
Description: Crystal structure of glutathione transferase BBTA-3750 from Bradyrhizobium sp., Target EFI-507290, with one glutathione bound
Class: transferase
Keywords: glutathione s-transferase, Enzyme Function Initiative, EFI, structural genomics, transferase
Deposited on 2013-11-05, released 2013-11-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-255)
Domains in SCOPe 2.05: d4nhza1, d4nhza2
Chain 'B':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (22-255)
  - expression tag (12-21)
  - expression tag (12-22)
Domains in SCOPe 2.05: d4nhzb1, d4nhzb2
Chain 'C':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-255)
Domains in SCOPe 2.05: d4nhzc1, d4nhzc2
Chain 'D':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-254)
Domains in SCOPe 2.05: d4nhzd1, d4nhzd2
Chain 'E':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-254)
Domains in SCOPe 2.05: d4nhze1, d4nhze2
Chain 'F':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-255)
Domains in SCOPe 2.05: d4nhzf1, d4nhzf2
Chain 'G':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-255)
Domains in SCOPe 2.05: d4nhzg1, d4nhzg2
Chain 'H':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (22-255)
  - expression tag (10-21)
  - expression tag (10-22)
Domains in SCOPe 2.05: d4nhzh1, d4nhzh2
Chain 'I':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-255)
Domains in SCOPe 2.05: d4nhzi1, d4nhzi2
Chain 'J':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-255)
Domains in SCOPe 2.05: d4nhzj1, d4nhzj2
Chain 'K':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-255)
Domains in SCOPe 2.05: d4nhzk1, d4nhzk2
Chain 'L':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-255)
Domains in SCOPe 2.05: d4nhzl1, d4nhzl2
Chain 'M':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-255)
Domains in SCOPe 2.05: d4nhzm1, d4nhzm2
Chain 'N':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-255)
Domains in SCOPe 2.05: d4nhzn1, d4nhzn2
Chain 'O':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-255)
Domains in SCOPe 2.05: d4nhzo1, d4nhzo2
Chain 'P':
Compound: Putative glutathione S-transferase enzyme with thioredoxin-like domain
Species: Bradyrhizobium sp. [TaxId:288000]
Gene: BBta_3750
Database cross-references and differences (RAF-indexed):
- Uniprot A5EI34 (Start-255)
Domains in SCOPe 2.05: d4nhzp1, d4nhzp2
Heterogens: GSH, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4nhzA (A:)
mhhhhhhssgvdlgtenlyfqsmsdlssfpitkrwpaqhsdriqlyslptpngvkvsiml
eetglpyephaidfgkdhqktpeflslnpngkipaiidpngpgdkplglfesgailqyla
ektgqflpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaesk
rllgvlearldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerg
larpavqrgleipkrp