![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
![]() | Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) ![]() |
![]() | Family b.10.1.4: Animal virus proteins [49656] (16 proteins) |
![]() | Protein Coxsackievirus B3 [49680] (1 species) |
![]() | Species Host: human (Homo sapiens) [49681] (1 PDB entry) |
![]() | Domain d1cov3_: 1cov 3: [23566] |
PDB Entry: 1cov (more details), 3.5 Å
SCOP Domain Sequences for d1cov3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cov3_ b.10.1.4 (3:) Coxsackievirus B3 {Host: human (Homo sapiens)} glptmntpgscqfltsddfqspsampqydvtpemripgevknlmeiaevdsvvpvqnvge kvnsmeayqipvrsnegsgtqvfgfplqpgyssvfsrtllgeilnyythwsgsikltfmf cgsamatgkfllaysppgagaptkrvdamlgthvvwdvglqsscvlcipwisqthyryva sdeytaggfitcwyqtnivvpadaqsscyimcfvsacndfsvrllkdtpfisqenffq
Timeline for d1cov3_: