Lineage for d1cov2_ (1cov 2:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 56533Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 56534Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 56646Family b.10.1.4: Animal virus proteins [49656] (16 proteins)
  6. 56662Protein Coxsackievirus B3 [49680] (1 species)
  7. 56663Species Host: human (Homo sapiens) [49681] (1 PDB entry)
  8. 56665Domain d1cov2_: 1cov 2: [23565]

Details for d1cov2_

PDB Entry: 1cov (more details), 3.5 Å

PDB Description: coxsackievirus b3 coat protein

SCOP Domain Sequences for d1cov2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cov2_ b.10.1.4 (2:) Coxsackievirus B3 {Host: human (Homo sapiens)}
gysdrvrsitlgnstittqecanvvvgygvwpdylkdseataedqptqpdvatcrfytld
svqwqktspgwwwklpdalsnlglfgqnmqyhylgrtgytihvqcnaskfhqgcllvvcv
peaemgcatlnntpssaellggdtakefadkpvasgsnklvqrvvynagmgvgvgnltif
phqwinlrtnnsativmpytnsvpmdnmfrhnnvtlmvipfvpldycpgsttyvpitvti
apmcaeynglrlaghq

SCOP Domain Coordinates for d1cov2_:

Click to download the PDB-style file with coordinates for d1cov2_.
(The format of our PDB-style files is described here.)

Timeline for d1cov2_: