Lineage for d1cov3_ (1cov 3:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 proteins)
  6. 11567Protein Coxsackievirus B3 [49680] (1 species)
  7. 11568Species Host: human (Homo sapiens) [49681] (1 PDB entry)
  8. 11571Domain d1cov3_: 1cov 3: [23566]

Details for d1cov3_

PDB Entry: 1cov (more details), 3.5 Å

PDB Description: coxsackievirus b3 coat protein

SCOP Domain Sequences for d1cov3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cov3_ b.10.1.4 (3:) Coxsackievirus B3 {Host: human (Homo sapiens)}
glptmntpgscqfltsddfqspsampqydvtpemripgevknlmeiaevdsvvpvqnvge
kvnsmeayqipvrsnegsgtqvfgfplqpgyssvfsrtllgeilnyythwsgsikltfmf
cgsamatgkfllaysppgagaptkrvdamlgthvvwdvglqsscvlcipwisqthyryva
sdeytaggfitcwyqtnivvpadaqsscyimcfvsacndfsvrllkdtpfisqenffq

SCOP Domain Coordinates for d1cov3_:

Click to download the PDB-style file with coordinates for d1cov3_.
(The format of our PDB-style files is described here.)

Timeline for d1cov3_: