SCOP 1.59: Domain d1cov1_: 1cov 1:

Lineage for d1cov1_ (1cov 1:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.4: Animal virus proteins [49656] (16 proteins)

6. Protein Coxsackievirus B3 [49680] (1 species)

7. Species Host: human (Homo sapiens) [49681] (1 PDB entry)

8. Domain d1cov1_: 1cov 1: [23564]

Details for d1cov1_

PDB Entry: 1cov, 3.5 Å

PDB Description: coxsackievirus b3 coat protein

SCOP Domain Sequences for d1cov1_:

Sequence; same for both SEQRES and ATOM records:

>d1cov1_ b.10.1.4 (1:) Coxsackievirus B3 {Host: human (Homo sapiens)}
rvadtvgtgptnseaipaltaaetghtsqvvpsdtmqtrhvknyhsrsestienflcrsa
cvyfteyensgakryaewvitprqaaqlrrklefftyvrfdleltfvitstqqpsttqnq
daqilthqimyvppggpvpdkvdsyvwqtstnpsvfwtegnapprmsvpflsignaysnf
ydgwsefsrngvygintlnnmgtlyarhvnagstgpikstiriyfkpkhvkawiprpprl
cqyekaknvnfqpsgvtttrqsittmtnt

Timeline for d1cov1_:

• d1cov1_ first appeared (with stable ids) in SCOP 1.55
  
• d1cov1_ appears in SCOP 1.57
  
• d1cov1_ appears in SCOP 1.61
  
• d1cov1_ appears in the current release, SCOPe 2.08