Lineage for d1cov1_ (1cov 1:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.4: Animal virus proteins [49656] (15 proteins) 
Protein Coxsackievirus B3 [49680] (1 species) Species Host: human (Homo sapiens) [49681] (1 PDB entry) 
Domain d1cov1_: 1cov 1: [23564]
Details for d1cov1_
PDB Entry: 1cov (more details), 3.5 Å
PDB Description: coxsackievirus b3 coat protein
SCOP Domain Sequences for d1cov1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cov1_ b.10.1.4 (1:) Coxsackievirus B3 {Host: human (Homo sapiens)}
rvadtvgtgptnseaipaltaaetghtsqvvpsdtmqtrhvknyhsrsestienflcrsa
cvyfteyensgakryaewvitprqaaqlrrklefftyvrfdleltfvitstqqpsttqnq
daqilthqimyvppggpvpdkvdsyvwqtstnpsvfwtegnapprmsvpflsignaysnf
ydgwsefsrngvygintlnnmgtlyarhvnagstgpikstiriyfkpkhvkawiprpprl
cqyekaknvnfqpsgvtttrqsittmtnt
SCOP Domain Coordinates for d1cov1_:
Click to download the PDB-style file with coordinates for d1cov1_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cov1_:
- d1cov1_ appears in SCOP 1.57
- d1cov1_ appears in the current release, SCOPe 2.08
View in 3D
