| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (71 species) not a true protein |
| Species Labrenzia aggregata [TaxId:384765] [228394] (1 PDB entry) |
| Domain d4mggb2: 4mgg B:128-367 [235617] Other proteins in same PDB: d4mgga1, d4mggb1, d4mggc1, d4mggd1, d4mgge1, d4mggf1, d4mggg1, d4mggh1 automated match to d4mggf2 complexed with cl, mg, ni |
PDB Entry: 4mgg (more details), 2.2 Å
SCOPe Domain Sequences for d4mggb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mggb2 c.1.11.0 (B:128-367) automated matches {Labrenzia aggregata [TaxId: 384765]}
aaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrihatrsvlkks
dllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpfvldevidgp
ntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggdivtaaiahl
arstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdvlgepvarys
Timeline for d4mggb2: