| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (83 species) not a true protein |
| Species Labrenzia aggregata [TaxId:384765] [228392] (1 PDB entry) |
| Domain d4mggc1: 4mgg C:1-127 [235618] Other proteins in same PDB: d4mgga2, d4mggb2, d4mggc2, d4mggd2, d4mgge2, d4mggf2, d4mggg2, d4mggh2 automated match to d4mggf1 complexed with cl, mg, ni |
PDB Entry: 4mgg (more details), 2.2 Å
SCOPe Domain Sequences for d4mggc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mggc1 d.54.1.0 (C:1-127) automated matches {Labrenzia aggregata [TaxId: 384765]}
mkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsaylps
yalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatgqp
lytllgg
Timeline for d4mggc1: