SCOPe 2.05: Domain d4mggf2: 4mgg F:128-367

Lineage for d4mggf2 (4mgg F:128-367)

Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)

binds metal ion (magnesium or manganese) in conserved site inside barrel
N-terminal alpha+beta domain is common to this superfamily

Family c.1.11.0: automated matches [227196] (1 protein)
not a true family
Protein automated matches [226923] (71 species)
not a true protein
Species Labrenzia aggregata [TaxId:384765] [228394] (1 PDB entry)
Domain d4mggf2: 4mgg F:128-367 [228395]
Other proteins in same PDB: d4mgga1, d4mggb1, d4mggc1, d4mggd1, d4mgge1, d4mggf1, d4mggg1, d4mggh1
automated match to d3fv9b2
complexed with cl, mg, ni

Details for d4mggf2

PDB Entry: 4mgg (more details), 2.2 Å

PDB Description: Crystal structure of an enolase (mandelate racemase subgroup) from labrenzia aggregata iam 12614 (target nysgrc-012903) with bound mg, space group p212121

PDB Compounds: (F:) muconate lactonizing enzyme

SCOPe Domain Sequences for d4mggf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mggf2 c.1.11.0 (F:128-367) automated matches {Labrenzia aggregata [TaxId: 384765]}
aaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrihatrsvlkks
dllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpfvldevidgp
ntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggdivtaaiahl
arstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdvlgepvarys

SCOPe Domain Coordinates for d4mggf2:

Click to download the PDB-style file with coordinates for d4mggf2.
(The format of our PDB-style files is described here.)

Timeline for d4mggf2: