Lineage for d4lujb1 (4luj B:21-233)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090271Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2091023Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2091024Protein automated matches [190292] (34 species)
    not a true protein
  7. 2091177Species Methanocaldococcus jannaschii [TaxId:243232] [235508] (3 PDB entries)
  8. 2091181Domain d4lujb1: 4luj B:21-233 [235509]
    Other proteins in same PDB: d4luja2, d4lujb2
    automated match to d4muza_
    complexed with bmp

Details for d4lujb1

PDB Entry: 4luj (more details), 1.6 Å

PDB Description: Crystal structure of Orotidine 5'-monophosphate decarboxylase from methanocaldococcus jannaschii complexed with inhibitor BMP
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d4lujb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lujb1 c.1.2.0 (B:21-233) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mpklmlaldvldrdralkivedvkdyvdaikvgyplvlstgteiikeikklcnkeviadf
kvadipatnekiakitlkyadgiivhgfvgedsvkavqdvakklnkkvimvtemshpgav
qflqpiadklsemakklkvdaivapstrperlkeikeiaelpvitpgvgaqggkiediln
ildendyvivgraiyqsqnpkeeakkykemlnk

SCOPe Domain Coordinates for d4lujb1:

Click to download the PDB-style file with coordinates for d4lujb1.
(The format of our PDB-style files is described here.)

Timeline for d4lujb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lujb2