Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (34 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:243232] [235508] (3 PDB entries) |
Domain d4lujb1: 4luj B:21-233 [235509] Other proteins in same PDB: d4luja2, d4lujb2 automated match to d4muza_ complexed with bmp |
PDB Entry: 4luj (more details), 1.6 Å
SCOPe Domain Sequences for d4lujb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lujb1 c.1.2.0 (B:21-233) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]} mpklmlaldvldrdralkivedvkdyvdaikvgyplvlstgteiikeikklcnkeviadf kvadipatnekiakitlkyadgiivhgfvgedsvkavqdvakklnkkvimvtemshpgav qflqpiadklsemakklkvdaivapstrperlkeikeiaelpvitpgvgaqggkiediln ildendyvivgraiyqsqnpkeeakkykemlnk
Timeline for d4lujb1: