SCOPe 2.05: Domain d4lujb_: 4luj B:

Lineage for d4lujb_ (4luj B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (26 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:243232] [235508] (3 PDB entries)

8. Domain d4lujb_: 4luj B: [235509]
   automated match to d4muza_
   complexed with bmp

Details for d4lujb_

PDB Entry: 4luj, 1.6 Å

PDB Description: Crystal structure of Orotidine 5'-monophosphate decarboxylase from methanocaldococcus jannaschii complexed with inhibitor BMP

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d4lujb_:

Sequence; same for both SEQRES and ATOM records:

>d4lujb_ c.1.2.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
hmpklmlaldvldrdralkivedvkdyvdaikvgyplvlstgteiikeikklcnkeviad
fkvadipatnekiakitlkyadgiivhgfvgedsvkavqdvakklnkkvimvtemshpga
vqflqpiadklsemakklkvdaivapstrperlkeikeiaelpvitpgvgaqggkiedil
nildendyvivgraiyqsqnpkeeakkykemlnk

Timeline for d4lujb_:

• d4lujb_ first appeared in SCOPe 2.03
  
• d4lujb_ appears in SCOPe 2.04
  
• d4lujb_ is called d4lujb1 in SCOPe 2.06
  
• d4lujb_ appears in the current release, SCOPe 2.08, called d4lujb1