Lineage for d4lkja_ (4lkj A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531708Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1531709Protein automated matches [227017] (14 species)
    not a true protein
  7. 1531739Species Influenza A virus [TaxId:11320] [228462] (9 PDB entries)
  8. 1531751Domain d4lkja_: 4lkj A: [235396]
    Other proteins in same PDB: d4lkjb_
    automated match to d4lkia_
    complexed with nag; mutant

Details for d4lkja_

PDB Entry: 4lkj (more details), 2.8 Å

PDB Description: the structure of hemagglutinin l226q mutant (h3 numbering) from a avian-origin h7n9 influenza virus (a/anhui/1/2013) in complex with avian receptor analog 3'slnln
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4lkja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lkja_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 11320]}
iclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtitg
ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgirt
ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvstaeq
tklygsgnklvtvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfngaf
iapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvkq
rslllatgmknvpe

SCOPe Domain Coordinates for d4lkja_:

Click to download the PDB-style file with coordinates for d4lkja_.
(The format of our PDB-style files is described here.)

Timeline for d4lkja_: