SCOPe 2.06: Domain d4jw0b_: 4jw0 B:

Lineage for d4jw0b_ (4jw0 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.15: EutN/CcmL-like [159133] (2 families)
   homohexameric unit

5. Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins)
   Pfam PF03319

6. Protein automated matches [227743] (1 species)
   not a true protein

7. Species Gloeobacter violaceus [TaxId:251221] [227744] (1 PDB entry)

8. Domain d4jw0b_: 4jw0 B: [235058]
   automated match to d4jw0d_
   complexed with so4

Details for d4jw0b_

PDB Entry: 4jw0, 1.7 Å

PDB Description: Structure of Gloeobacter violaceus CcmL

PDB Compounds: (B:) Carbon dioxide concentrating mechanism protein

SCOPe Domain Sequences for d4jw0b_:

Sequence; same for both SEQRES and ATOM records:

>d4jw0b_ b.40.15.1 (B:) automated matches {Gloeobacter violaceus [TaxId: 251221]}
mqigrvrgtvvssqkepsmvgvkflllqlideagqplpqyevaadgvgagldewvlfsrg
saarqvagsekrpvdavvigiidtvsvdnrplyskkd

Timeline for d4jw0b_:

• d4jw0b_ first appeared in SCOPe 2.03
  
• d4jw0b_ appears in SCOPe 2.05
  
• d4jw0b_ appears in SCOPe 2.07
  
• d4jw0b_ appears in the current release, SCOPe 2.08