Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.15: EutN/CcmL-like [159133] (2 families) homohexameric unit |
Family b.40.15.1: EutN/CcmL-like [159134] (4 proteins) Pfam PF03319 |
Protein automated matches [227743] (1 species) not a true protein |
Species Gloeobacter violaceus [TaxId:251221] [227744] (1 PDB entry) |
Domain d4jw0a_: 4jw0 A: [235056] automated match to d4jw0d_ complexed with so4 |
PDB Entry: 4jw0 (more details), 1.7 Å
SCOPe Domain Sequences for d4jw0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jw0a_ b.40.15.1 (A:) automated matches {Gloeobacter violaceus [TaxId: 251221]} mqigrvrgtvvssqkepsmvgvkflllqlideagqplpqyevaadgvgagldewvlfsrg saarqvagsekrpvdavvigiidtvsvdnrplysk
Timeline for d4jw0a_:
View in 3D Domains from other chains: (mouse over for more information) d4jw0b_, d4jw0c_, d4jw0d_, d4jw0e_ |