![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.223: Polo-box domain [82614] (1 superfamily) beta(6)-alpha; antiparallel beta-sheet, meander |
![]() | Superfamily d.223.1: Polo-box domain [82615] (2 families) ![]() Serine/threonine protein kinase-associated motif embedded in two distinct folds |
![]() | Family d.223.1.2: Polo-box duplicated region [102856] (1 protein) duplication: consists of two polo-box domains; binds phosphothreonine peptide |
![]() | Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species) |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [234931] (1 PDB entry) |
![]() | Domain d4j7bb2: 4j7b B:492-585 [234933] Other proteins in same PDB: d4j7ba_, d4j7bd_ automated match to d3bzia2 |
PDB Entry: 4j7b (more details), 2.3 Å
SCOPe Domain Sequences for d4j7bb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j7bb2 d.223.1.2 (B:492-585) Serine/threonine-protein kinase plk C-terminal domain {Zebrafish (Danio rerio) [TaxId: 7955]} egdeltrlpylrhwfrtksaivlhlsngtvqinffqdhtklilcplmgavtyinekrefy tykmtlieefgcckelasrlryarnmveklmack
Timeline for d4j7bb2:
![]() Domains from other chains: (mouse over for more information) d4j7ba_, d4j7bd_, d4j7be1, d4j7be2 |