SCOPe 2.03: Domain d4j7bb2: 4j7b B:492-585

Lineage for d4j7bb2 (4j7b B:492-585)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.223: Polo-box domain [82614] (1 superfamily)
   beta(6)-alpha; antiparallel beta-sheet, meander

4. Superfamily d.223.1: Polo-box domain [82615] (2 families)
   Serine/threonine protein kinase-associated motif embedded in two distinct folds

5. Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
   duplication: consists of two polo-box domains; binds phosphothreonine peptide

6. Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)

7. Species Danio rerio [TaxId:7955] [234931] (1 PDB entry)

8. Domain d4j7bb2: 4j7b B:492-585 [234933]
   Other proteins in same PDB: d4j7ba_
   automated match to d3bzia2

Details for d4j7bb2

PDB Entry: 4j7b, 2.3 Å

PDB Description: crystal structure of polo-like kinase 1

PDB Compounds: (B:) Polo-like kinase

SCOPe Domain Sequences for d4j7bb2:

Sequence; same for both SEQRES and ATOM records:

>d4j7bb2 d.223.1.2 (B:492-585) Serine/threonine-protein kinase plk C-terminal domain {Danio rerio [TaxId: 7955]}
egdeltrlpylrhwfrtksaivlhlsngtvqinffqdhtklilcplmgavtyinekrefy
tykmtlieefgcckelasrlryarnmveklmack

Timeline for d4j7bb2:

• d4j7bb2 is new in SCOPe 2.03-stable
  
• d4j7bb2 appears in SCOPe 2.04
  
• d4j7bb2 appears in the current release, SCOPe 2.08