Lineage for d4j7bb2 (4j7b B:492-585)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1446678Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 1446679Superfamily d.223.1: Polo-box domain [82615] (2 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 1446685Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
    duplication: consists of two polo-box domains; binds phosphothreonine peptide
  6. 1446686Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)
  7. 1446687Species Danio rerio [TaxId:7955] [234931] (1 PDB entry)
  8. 1446689Domain d4j7bb2: 4j7b B:492-585 [234933]
    Other proteins in same PDB: d4j7ba_
    automated match to d3bzia2

Details for d4j7bb2

PDB Entry: 4j7b (more details), 2.3 Å

PDB Description: crystal structure of polo-like kinase 1
PDB Compounds: (B:) Polo-like kinase

SCOPe Domain Sequences for d4j7bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j7bb2 d.223.1.2 (B:492-585) Serine/threonine-protein kinase plk C-terminal domain {Danio rerio [TaxId: 7955]}
egdeltrlpylrhwfrtksaivlhlsngtvqinffqdhtklilcplmgavtyinekrefy
tykmtlieefgcckelasrlryarnmveklmack

SCOPe Domain Coordinates for d4j7bb2:

Click to download the PDB-style file with coordinates for d4j7bb2.
(The format of our PDB-style files is described here.)

Timeline for d4j7bb2: