| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.6: NeuB-like [110368] (3 proteins) Pfam PF03102 |
| Protein automated matches [231473] (2 species) not a true protein |
| Species Neisseria meningitidis [TaxId:487] [234892] (2 PDB entries) |
| Domain d4ipja1: 4ipj A:-1-281 [234896] Other proteins in same PDB: d4ipja2 automated match to d1xuua2 complexed with lmr, mn |
PDB Entry: 4ipj (more details), 2.15 Å
SCOPe Domain Sequences for d4ipja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ipja1 c.1.10.6 (A:-1-281) automated matches {Neisseria meningitidis [TaxId: 487]}
gamqnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthi
vedemsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaal
rlqrmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpya
llhctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhft
drmdrpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag
Timeline for d4ipja1: