SCOPe 2.03: Domain d4ipja2: 4ipj A:282-349

Lineage for d4ipja2 (4ipj A:282-349)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.1: AFP III-like domain [51269] (2 families)
   duplication: consists of two structural repeats related by pseudo dyad

5. Family b.85.1.0: automated matches [231476] (1 protein)
   not a true family

6. Protein automated matches [231477] (2 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:487] [234894] (2 PDB entries)

8. Domain d4ipja2: 4ipj A:282-349 [234897]
   Other proteins in same PDB: d4ipja1
   automated match to d1xuua1
   complexed with lmr, mn

Details for d4ipja2

PDB Entry: 4ipj, 2.15 Å

PDB Description: Crystal Structure of R314K N-acetyl Neuraminic Acid Synthase from Neiserria meningitidis with Malate bound

PDB Compounds: (A:) polysialic acid capsule biosynthesis protein SiaC

SCOPe Domain Sequences for d4ipja2:

Sequence; same for both SEQRES and ATOM records:

>d4ipja2 b.85.1.0 (A:282-349) automated matches {Neisseria meningitidis [TaxId: 487]}
ekptkdfafasvvadkdikkgellsgdnlwvkkpgngdfsvneyetlfgkvaacnirkga
qikktdie

Timeline for d4ipja2:

• d4ipja2 is new in SCOPe 2.03-stable
  
• d4ipja2 appears in SCOPe 2.04
  
• d4ipja2 appears in the current release, SCOPe 2.08