Lineage for d4ipja1 (4ipj A:1-281)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835884Family c.1.10.6: NeuB-like [110368] (3 proteins)
    Pfam PF03102
  6. 2835897Protein automated matches [231473] (2 species)
    not a true protein
  7. 2835898Species Neisseria meningitidis [TaxId:487] [234892] (2 PDB entries)
  8. 2835900Domain d4ipja1: 4ipj A:1-281 [234896]
    Other proteins in same PDB: d4ipja2, d4ipja3
    automated match to d1xuua2
    complexed with lmr, mn

Details for d4ipja1

PDB Entry: 4ipj (more details), 2.15 Å

PDB Description: Crystal Structure of R314K N-acetyl Neuraminic Acid Synthase from Neiserria meningitidis with Malate bound
PDB Compounds: (A:) polysialic acid capsule biosynthesis protein SiaC

SCOPe Domain Sequences for d4ipja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ipja1 c.1.10.6 (A:1-281) automated matches {Neisseria meningitidis [TaxId: 487]}
mqnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthive
demsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrl
qrmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyall
hctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdr
mdrpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag

SCOPe Domain Coordinates for d4ipja1:

Click to download the PDB-style file with coordinates for d4ipja1.
(The format of our PDB-style files is described here.)

Timeline for d4ipja1: